|
Structure |
Selenomethionyl derivative of a GID4 fragment |
|
PDB Code |
6CCR |
|
Entry clone accession |
BC041829.1 |
|
Entry clone source |
MGC:43491 IMAGE:5268071 |
|
SGC clone accession |
JMC130-A06 |
|
Tag |
N-terminal tag: MHHHHHHSSGRENLYFQG |
|
Construct sequence |
MHHHHHHSSGRENLYFQG GVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYL CGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVD RKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKE QFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR |
|
Vector |
pET28-MHL |
|
Expression host |
BL21 (DE3) Codon plus RIL (Stratagene) |
|
Growth method |
GID4 was expressed in E.coli BL21 (DE3) codon plus RIL in Terrific Broth (TB) in the presence of 50 µg/mL of kanamycin. Cell were grown at 37 ºC to an OD600 of 1.5 and induced by isopropyl-1-thio-D-galactopyranoside (IPTG), final concentration 0.2 mM, and incubated overnight at 16 ºC. Cell pellets collected by centrifugation and frozen at -80 ºC. To prepare selenomethionine (SeMet) derivatives, SeMet-GID4 (aa 116-300) was overexpressed in the prepacked M9 SeMet growth media kit (Medicilon) following manufacturer’s instructions. |
|
Extraction buffers |
Lysis buffer: 20 mM Tris-HCl pH 7.5, 400 mM NaCl, 5% glycerol and 2 mM beta-mercaptoethanol |
|
Extraction procedure |
Frozen cell pellet was thawed and suspended in lysis buffer. The cells were lysed by sonication (Virtis408912, Virsonic) on ice: the sonication protocol was 5 sec pulse at half-maximal frequency (5.0), 7 second rest, for 10 minutes total sonication time per pellet. The lysate was centrifuged at 15000rpm for 1h. |
|
Purification buffers |
Wash buffer: 20 mM Tris pH 7.5, 400 mM NaCl, 5% glycerol and 25 mM imidazole; |
|
Purification procedure |
The fusion proteins were purified by Ni-NTA agarose column. The His tag was cleaved by His-tagged TEV protease (purified in-house) with an approximate molar ratio of 1 : 20 in the dialysis buffer (20 mM Tris-HCl, pH 7.5, 150 mM NaCl and 5 mM beta-mercaptoethanol) at 4 °C overnight. The tag and protease were removed by reloading onto the Ni-NTA. The proteins were further purified by Superdex 200 10/300 (GE Healthcare). The gel filtration buffer contains 20 mM Tris-HCl, pH 7.5, 100 mM NaCl and 0.5 mM TCEP |
|
Protein stock concentration |
The purified protein was concentrated to 8 mg mL-1 using 15 mL concentrators with a 3,000 molecular weight cut-off (Amicon Ultra-15, UFC900524, Millipore). |
|
Crystallization |
The crystals were grown at 18 °C using sitting drop method by mixing 1 microl protein and 1 microl reservoir solution (10% (v/v) 2-propanol, 20% (v/v) PEG4000 and 0.1 M Na-HEPES, pH 7.5). The SeMet-labelled proteins were obtained under similar crystallization conditions of wild type. |