Entry clone accession   PF08_0034:MAC04J-B11:C229648

SGC clone accession     PF08_0034:MAC04J-B11:C229648

Tag     removed

Construct sequence      HKEVQLKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQTLIWPKYEAI

Vector  pET15-MHL

Expression host BL21(DE3)-V3R-pRARE2

Growth medium   TB with MgSO4 and Trace Element

Growth method - do not change for all   Express plasmid in E. coli BL21(DE3)-pRARE2 on LB agar (Luria broth) plate in the presence of ampicillin(100 µg/ml)+chloramphenicol (34 µg/mL). A single colony was inoculated into 25 mL of TB with ampicillin(100mg/ml)+chloramphenicol (34 mg/mL) in a 50 mL falcon tube and incubated with shaking at 220 rpm overnight at 37 ºC. Then the culture was transfer into 1L of TB with ampicillin(100mg/ml)+chloramphenicol (34 mg/mL), 9ml 0.8M MgSO4, 180ul trace element and 0.5 mL of antifoam (Sigma) in a 1 L bottle and cultured using the LEX system to an OD600 of ~5, cooled to 15 ºC, and induced with 0.5 mM isopropyl-1-thio-D-galactopyranoside (IPTG) overnight at 15 ºC

Extraction buffers - do not change      Binding Buffer: 50 mM HEPES pH 7.5, 500 mM NaCl, 5 mM imidazole, and 5 % glycerol

Extraction procedure - do not change    The culture was harvested by centrifugation.  Pellets from 1 L of culture were resuspended to approximately 40 mL/L of cell culture in Binding Buffer with the addition of protease inhibitors (1 mM benzamidine and 1 mM phenylmethyl sulfonyl fluoride (PMSF)). Resuspended pellets stored at -80oC were thawed overnight at 4 °C on the day before purification.  Prior to lysis, each pellet from 1 L of culture was pretreated with protease inhibitors, 0.5% CHAPS and 500 units of benzonase. Each liter of cells were sonicated for effective time 5 minutes(about 120 watts, pulsed 10s on, 10s off) and the cell lysate was centrifuged using a Beckman JA-16.25 rotor at 16,000 rpms for an hour at 10 ºC

Purification buffers - do not change    Wash Buffer: 50 mM HEPES pH 7.5, 500 mM NaCl, 30 mM imidazole, and 5 % glycerol

        Elution Buffer: 50 mM HEPES pH 7.5, 500 mM NaCl, 250 mM imidazole, and 5 % glycerol

        Gel Filtration buffer: 20mM HEPES 7.5 and 150 mM NaCl.

Purification procedure - do not change  The cleared lysate was loaded onto a 2 mL Ni-NTA (Qiagen) column pre-equilibrated with Binding Buffer at approximately 1 – 1.5 mL/min. After the lysate was loaded, the column was then washed with at least 200 mL of Wash Buffer. After washing, the protein was eluted with 15 mL of Elution Buffer and treated with 1mM TCEP.

        The sample was then loaded onto a superdex 200 gel filtration column. The eluted protein was concentrated using a 15 mL Amicon Ultra centrifugal filter device (Millipore) with a 10 kDa cutoff. The protein was concentrated to 14 mg/mL and flash frozen in N2(l) and stored at -80C.

Protein concentration   protein concentration:10 mg/ml

Crystallization "Vapor Diffusion Sitting Drop

pH       4

Temperature     277.0

2.0 M Ammonium sulfate 0.1 M sodium acetate pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature "