UHRF1


PDB:3BI7

 

Revision


Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:NP_037414
Entry Clone Source:ubh12.BC113875.OBS.MHS4426-98361361.pCR-BluntIITOPO
SGC Clone Accession:ubh12.414.617.125B05 (SDC125B05)
Tag:N-terminal: M
C-terminal: AHHHHHH
Host:BL21 (DE3)

 

 

Construct


Prelude:
Sequence:

MPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANAHHHHHH

Vector:pNIC-CH

 

 

Growth


Medium:
Antibiotics:
Procedure:The protein was expressed in E. coli BL21 (DE3) grown in Terrific Broth (TB) in the presence of 50 µg/ml of kanamycin at 37ºC to an OD600 of 7.5. Protein expression was induced 0.05 mM isopropyl-1-thio-D-galactopyranoside (IPTG) overnight at 15ºC. The culture was centrifuged (12,000 x g, 15 minutes) and cell pellets collected and stored at -80ºC. In order to obtain the selenomethionyl derivative of the UHRF1 SRA domain, the cells were grown in M9 medium supplemented with glycerol using a M9 SeMET High-Yield growth media kit package (MD045004-50L, Medicilon) according to manufacturer’s instructuion and the protein was purified as below.

 

 

Purification


Procedure
Column 1: TALON metal-affinity resin column (BD Biosciences)
Column 2: HighLoad 16/60 Superdex 200 column (GE Healthcare, Amersham)

The cleared lysate was loaded onto a 3 mL TALON metal-affinity resin column (BD Biosciences) at 4ºC. The column was washed with 10 mL Wash buffer A, 10 mL Wash buffer B, and 10 mL Wash buffer A. The protein was eluted with 6 mL Elution buffer.

The protein was further purified by gel filtration on a HighLoad 16/60 Superdex 200 column (GE Healthcare, Amersham) equilibrated with Gel Filtration buffer. Fractions containing protein (analyzed by SDS-PAGE) were pooled and concentrated by ultrafiltration using an Amicon Ultra centrifugal filter with 10 kD cutoff to a final concentration of 34 mg/ml.The yields of the protein and its selenomethionyl derivatives were approx. 4 and 9 mg per liter of bacterial culture, respectively.

 

 

Extraction


Procedure
The cell pellet from a 2 L culture was resuspended in 50 ml Lysis buffer, lysed using a Microfluidizer at 18,000 PSI, and cleared by centrifugation at 40,000 x g for 30 min.
Concentration:34 mg/ml.
Ligand
MassSpec:Mass-spectroscopy by LCMS showed pure product of correct molecular weight corresponding the SRA selenomethionyl derivative lacking N-terminal methionine residue (removed by bacterial aminopeptidase in the course of protein expression) and two other methionine residues substituted with selenomethionine
Crystallization:Crystals of the UHRF1 SRA domain selenomethionyl derivative were grown at 298 K using the hanging drop method by mixing 1 volume of 34 mg/ml protein with 1 volume of well solution consisting of 1.4 M ammonium sulfate, 0.1 M bis-Tris, pH 6.0, 0.2 M NaCl and 1 mM TCEP. The crystals were cryoprotected by immersion in the well solution mixed in 1:1 ratio with a water solution containing 20% (w/v) sucrose, 4% (w/v) glucose, 18% (v/v) glycerol and 18% (v/v) ethylene glycol.
NMR Spectroscopy:
Data Collection:
Data Processing: