PAK4
PDB:2BVA
Revision
Revision Type:created
Revised by:created
Revision Date:created
Entry Clone Accession:gi|5031975
Entry Clone Source:TKC
SGC Clone Accession:PAK4A-c010
Tag:N-terminal tag: mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiawplqgwqatfgggdhppksdlevlfq*gplgs
Host:BL21 (DE3)
Construct
Prelude:
Sequence:
gplgsSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Vector:pGEX-6P2
Growth
Medium:
Antibiotics:
Procedure:Starter cultures from freshly transformed colonies in 10 ml LB, 0.1 mg/ml ampicillin were grown overnight. This was diluted 1:1000 in fresh media (6L) and was grown at 37°C to an OD600 of 0.3 and than transferred to 18°C. Expression was induced at an OD600 of 0.8 using 1 mM IPTG. Cells were harvested after 12h by centrifugation, transferred to 50-ml tubes, and frozen in liquid nitrogen.
Purification
Procedure
Column 1 : Glutathione Sepharose 4B affinity, 5 ml of 50% slurry in 1.5 x 10 cm column, washed with binding buffer.
Column 2 : SEC (S75 or S200)
Supernatant was applied at gravity flow, followed by a wash with 30 ml binding buffer. The GST-fusion was cleaved while bound to the column by addition of PreScission protease. The column was gently rotated overnight a 4°C. The protein was subsequently eluted with 3 bed volumes of binding buffer.
Fractions containing PAK4 were concentrated and applied to a S75 gel fitration column equilibrated in SEC buffer. PAK4 eluted with a retention time corresponding to a monomeric protein of 40 kDa.
Extraction
Procedure
The cell pellets (20 g wet wt) were re-suspended in 50 ml extraction buffer, and lysed by a high pressure cell disrupter. Supernatant was centrifuged for 30 minutes at 60,000 rpm.
Concentration:Centricons 10 kDa cut off in same buffer. The mass of the recombinant Pak4 corresponded to the expected mass and one PO4 moiety. The protein was >95% pure as judged by SDS PAGE. ESI-MS spectra showed that the recombinant protein had a molecular weight of 34456- which corresponds to the mono-phosphorylated protein, in agreement with the theoretical mass of 34376 Da.
Ligand
MassSpec:
Crystallization:Pak4 apo hexagonal crystal form: Pak4 was concentrated to 10 mg/ml. The protein was crystallized is 96 well sitting drop Greiner plates using the vapour diffusion method at 4°C mixing 100 nl protein solution with a well solution containing 1.5M NaCl and 10% (v/v) ethanol. Crystals were frozen in the crystallization buffer containing 25% ethylene glycole.
NMR Spectroscopy:
Data Collection:Resolution: 2.3Å ; X-ray source: SLS-X10
Data Processing: