mhhhhhhssgvdlgtenlyfqsmSRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYD IPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVS TVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLR LISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSA GIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQ LSHQS
Loading buffer: 50 mM Hepes, pH 7.5, 500 mM NaCl, 10 mM imidazole, 0.5 mM TCEP, 5% glycerol. Wash buffer: 50 mM Hepes, pH 7.5, 500 mM NaCl, 50 mM imidazole, 0.5 mM TCEP, 5% glycerol.Elution buffer: 50 mM Hepesl, pH 7.5, 500 mM NaCl, 250 mM imidazole, 0.5 mM TCEP, 5% glycerol. Procedure: The cell extract was loaded on the column at 0.8 ml/minute on an AKTA-express system (GE/Amersham). The column was then washed with 10 volumes of Loading buffer, 10 volumes of wash buffer, then eluted with elution buffer at 0.8 ml/min. The eluted peak of A280 was automatically collected.
SEC: The peak collected from IMAC was directly applied to a S75 column equilibrated in 50 mM Hepes pH 7.5, 500 m NaCl, 5% glycerol.
Procedure: Akta Express
HiTrap Q: IEX buffer A: 50 mM Hepes, pH 7.5, 10% glycerol. IEX buffer B: 50 mM Hepes, pH 7.5, 1.0 M NaCl.
Protein fraction from desalting column loaded at 1 ml/min, the column was then washed with 10 ml of buffer A and eluted with a 20-minute gradient to 50% buffer B, followed by a step to 100% buffer B.
Concentration: Centricons 10 kDa cut off